Lineage for d2bdja1 (2bdj A:257-521)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734788Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 734791Species Human (Homo sapiens) [TaxId:9606] [56156] (6 PDB entries)
  8. 734798Domain d2bdja1: 2bdj A:257-521 [128338]
    automatically matched to d1fmk_3
    complexed with het

Details for d2bdja1

PDB Entry: 2bdj (more details), 2.5 Å

PDB Description: Src kinase in complex with inhibitor AP23464
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d2bdja1:

Sequence, based on SEQRES records: (download)

>d2bdja1 d.144.1.7 (A:257-521) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkepeerptfeylqafledyft

Sequence, based on observed residues (ATOM records): (download)

>d2bdja1 d.144.1.7 (A:257-521) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliefpikwtapeaalygrftiksdvws
fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp
tfeylqafledyft

SCOP Domain Coordinates for d2bdja1:

Click to download the PDB-style file with coordinates for d2bdja1.
(The format of our PDB-style files is described here.)

Timeline for d2bdja1: