SCOPe 2.03: Domain d2bdfb_: 2bdf B:

Lineage for d2bdfb_ (2bdf B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (7 PDB entries)

8. Domain d2bdfb_: 2bdf B: [128337]
   automated match to d3bz3a_
   complexed with 24a

Details for d2bdfb_

PDB Entry: 2bdf, 2.1 Å

PDB Description: Src kinase in complex with inhibitor AP23451

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d2bdfb_:

Sequence, based on SEQRES records:

>d2bdfb_ d.144.1.7 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
kklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgm
ayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaa
lygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdl
mcqcwrkepeerptfeylqafledyftstepqyq

Sequence, based on observed residues (ATOM records):

>d2bdfb_ d.144.1.7 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
kklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgm
ayvermnyvhrdlraanilvgenlvckvadfglarlieakfpikwtapeaalygrftiks
dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
eerptfeylqafledyftstepqyq

Timeline for d2bdfb_:

• d2bdfb_ first appeared in SCOP 1.73, called d2bdfb1
  
• d2bdfb_ was called d2bdfb1 in SCOPe 2.02
  
• d2bdfb_ appears in SCOPe 2.04
  
• d2bdfb_ appears in the current release, SCOPe 2.08