Lineage for d2bdfb1 (2bdf B:257-528)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734788Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 734791Species Human (Homo sapiens) [TaxId:9606] [56156] (6 PDB entries)
  8. 734797Domain d2bdfb1: 2bdf B:257-528 [128337]
    automatically matched to d1fmk_3
    complexed with 24a

Details for d2bdfb1

PDB Entry: 2bdf (more details), 2.1 Å

PDB Description: Src kinase in complex with inhibitor AP23451
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d2bdfb1:

Sequence, based on SEQRES records: (download)

>d2bdfb1 d.144.1.7 (B:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkepeerptfeylqafledyftstepqyq

Sequence, based on observed residues (ATOM records): (download)

>d2bdfb1 d.144.1.7 (B:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarlieakfpikwtapeaalygrftiksdv
wsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepee
rptfeylqafledyftstepqyq

SCOP Domain Coordinates for d2bdfb1:

Click to download the PDB-style file with coordinates for d2bdfb1.
(The format of our PDB-style files is described here.)

Timeline for d2bdfb1: