Lineage for d2bdfa1 (2bdf A:257-528)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874405Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 874408Species Human (Homo sapiens) [TaxId:9606] [56156] (8 PDB entries)
  8. 874414Domain d2bdfa1: 2bdf A:257-528 [128336]
    automatically matched to d1fmk_3
    complexed with 24a

Details for d2bdfa1

PDB Entry: 2bdf (more details), 2.1 Å

PDB Description: Src kinase in complex with inhibitor AP23451
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d2bdfa1:

Sequence, based on SEQRES records: (download)

>d2bdfa1 d.144.1.7 (A:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkepeerptfeylqafledyftstepqyq

Sequence, based on observed residues (ATOM records): (download)

>d2bdfa1 d.144.1.7 (A:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliefpikwtapeaalygrftiksdvws
fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp
tfeylqafledyftstepqyq

SCOP Domain Coordinates for d2bdfa1:

Click to download the PDB-style file with coordinates for d2bdfa1.
(The format of our PDB-style files is described here.)

Timeline for d2bdfa1: