![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein c-src tyrosine kinase [56155] (2 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56156] (8 PDB entries) |
![]() | Domain d2bdfa1: 2bdf A:257-528 [128336] automatically matched to d1fmk_3 complexed with 24a |
PDB Entry: 2bdf (more details), 2.1 Å
SCOP Domain Sequences for d2bdfa1:
Sequence, based on SEQRES records: (download)
>d2bdfa1 d.144.1.7 (A:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc qcwrkepeerptfeylqafledyftstepqyq
>d2bdfa1 d.144.1.7 (A:257-528) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarliefpikwtapeaalygrftiksdvws fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp tfeylqafledyftstepqyq
Timeline for d2bdfa1: