Lineage for d2bdfa_ (2bdf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542545Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542642Species Human (Homo sapiens) [TaxId:9606] [56156] (13 PDB entries)
  8. 2542645Domain d2bdfa_: 2bdf A: [128336]
    automated match to d3bz3a_
    complexed with 24a

Details for d2bdfa_

PDB Entry: 2bdf (more details), 2.1 Å

PDB Description: Src kinase in complex with inhibitor AP23451
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d2bdfa_:

Sequence, based on SEQRES records: (download)

>d2bdfa_ d.144.1.7 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkepeerptfeylqafledyftstepqyq

Sequence, based on observed residues (ATOM records): (download)

>d2bdfa_ d.144.1.7 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliefpikwtapeaalygrftiksdvws
fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp
tfeylqafledyftstepqyq

SCOPe Domain Coordinates for d2bdfa_:

Click to download the PDB-style file with coordinates for d2bdfa_.
(The format of our PDB-style files is described here.)

Timeline for d2bdfa_: