SCOPe 2.05: Domain d2bdea1: 2bde A:2-459

Lineage for d2bdea1 (2bde A:2-459)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.23: 5' nucleotidase-like [142191] (1 protein)
   Pfam PF05761; the insertion domain cosists of 3-helical bundle and a pseudo beta-barrel; contains extra C-terminal long alpha hairpin subdomain (46556)

6. Protein Cytosolic IMP-GMP specific 5'-nucleotidase [142192] (2 species)

7. Species Legionella pneumophila [TaxId:446] [142193] (1 PDB entry)
   Uniprot Q5ZZB6 2-459

8. Domain d2bdea1: 2bde A:2-459 [128335]
   complexed with so4

Details for d2bdea1

PDB Entry: 2bde, 2.9 Å

PDB Description: crystal structure of the cytosolic imp-gmp specific 5'-nucleotidase (lpg0095) from legionella pneumophila, northeast structural genomics target lgr1

PDB Compounds: (A:) cytosolic IMP-GMP specific 5'-nucleotidase

SCOPe Domain Sequences for d2bdea1:

Sequence; same for both SEQRES and ATOM records:

>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]}
dthkvfvnriinmrkikligldmdhtlirynsknfeslvydlvkerlaesfhypeeikkf
kfnfddairglvidskngnilklsrygairlsyhgtkqisfsdqkkiyrsiyvdlgdpny
maidtsfsiafcilygqlvdlkdtnpdkmpsyqaiaqdvqycvdkvhsdgtlkniiiknl
kkyvirekevveglkhfirygkkifiltnseysyskllldyalspfldkgehwqglfefv
itlankprffydnlrflsvnpengtmtnvhgpivpgvyqggnakkftedlgvggdeilyi
gdhiygdilrlkkdcnwrtalvveelgeeiasqiralpiekkigeamaikkeleqkyvdl
ctrsidessqqydqeihdlqlqistvdlqisrllqeqnsfynpkwervfragaeesyfay
qvdrfaciymeklsdllehspmtyfranrrllahdidi

Timeline for d2bdea1:

• d2bdea1 first appeared in SCOP 1.73
  
• d2bdea1 appears in SCOPe 2.04
  
• d2bdea1 appears in SCOPe 2.06
  
• d2bdea1 appears in the current release, SCOPe 2.08