Lineage for d2bdea1 (2bde A:2-459)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920252Family c.108.1.23: 5' nucleotidase-like [142191] (1 protein)
    Pfam PF05761; the insertion domain cosists of 3-helical bundle and a pseudo beta-barrel; contains extra C-terminal long alpha hairpin subdomain (46556)
  6. 2920253Protein Cytosolic IMP-GMP specific 5'-nucleotidase [142192] (2 species)
  7. 2920260Species Legionella pneumophila [TaxId:446] [142193] (1 PDB entry)
    Uniprot Q5ZZB6 2-459
  8. 2920261Domain d2bdea1: 2bde A:2-459 [128335]
    complexed with so4

Details for d2bdea1

PDB Entry: 2bde (more details), 2.9 Å

PDB Description: crystal structure of the cytosolic imp-gmp specific 5'-nucleotidase (lpg0095) from legionella pneumophila, northeast structural genomics target lgr1
PDB Compounds: (A:) cytosolic IMP-GMP specific 5'-nucleotidase

SCOPe Domain Sequences for d2bdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]}
dthkvfvnriinmrkikligldmdhtlirynsknfeslvydlvkerlaesfhypeeikkf
kfnfddairglvidskngnilklsrygairlsyhgtkqisfsdqkkiyrsiyvdlgdpny
maidtsfsiafcilygqlvdlkdtnpdkmpsyqaiaqdvqycvdkvhsdgtlkniiiknl
kkyvirekevveglkhfirygkkifiltnseysyskllldyalspfldkgehwqglfefv
itlankprffydnlrflsvnpengtmtnvhgpivpgvyqggnakkftedlgvggdeilyi
gdhiygdilrlkkdcnwrtalvveelgeeiasqiralpiekkigeamaikkeleqkyvdl
ctrsidessqqydqeihdlqlqistvdlqisrllqeqnsfynpkwervfragaeesyfay
qvdrfaciymeklsdllehspmtyfranrrllahdidi

SCOPe Domain Coordinates for d2bdea1:

Click to download the PDB-style file with coordinates for d2bdea1.
(The format of our PDB-style files is described here.)

Timeline for d2bdea1: