Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.23: 5' nucleotidase-like [142191] (1 protein) Pfam PF05761; the insertion domain cosists of 3-helical bundle and a pseudo beta-barrel; contains extra C-terminal long alpha hairpin subdomain (46556) |
Protein Cytosolic IMP-GMP specific 5'-nucleotidase [142192] (2 species) |
Species Legionella pneumophila [TaxId:446] [142193] (1 PDB entry) Uniprot Q5ZZB6 2-459 |
Domain d2bdea1: 2bde A:2-459 [128335] complexed with so4 |
PDB Entry: 2bde (more details), 2.9 Å
SCOPe Domain Sequences for d2bdea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} dthkvfvnriinmrkikligldmdhtlirynsknfeslvydlvkerlaesfhypeeikkf kfnfddairglvidskngnilklsrygairlsyhgtkqisfsdqkkiyrsiyvdlgdpny maidtsfsiafcilygqlvdlkdtnpdkmpsyqaiaqdvqycvdkvhsdgtlkniiiknl kkyvirekevveglkhfirygkkifiltnseysyskllldyalspfldkgehwqglfefv itlankprffydnlrflsvnpengtmtnvhgpivpgvyqggnakkftedlgvggdeilyi gdhiygdilrlkkdcnwrtalvveelgeeiasqiralpiekkigeamaikkeleqkyvdl ctrsidessqqydqeihdlqlqistvdlqisrllqeqnsfynpkwervfragaeesyfay qvdrfaciymeklsdllehspmtyfranrrllahdidi
Timeline for d2bdea1: