Lineage for d2bdba1 (2bdb A:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670617Protein Elastase [50536] (4 species)
  7. 670625Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)
  8. 670644Domain d2bdba1: 2bdb A:16-245 [128333]
    automatically matched to d1esb__
    complexed with ala, ca, so4

Details for d2bdba1

PDB Entry: 2bdb (more details), 1.7 Å

PDB Description: porcine pancreatic elastase complexed with asn-pro-ile and ala-ala at ph 5.0
PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2bdba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdba1 b.47.1.2 (A:16-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d2bdba1:

Click to download the PDB-style file with coordinates for d2bdba1.
(The format of our PDB-style files is described here.)

Timeline for d2bdba1: