Lineage for d2bd8a1 (2bd8 A:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670617Protein Elastase [50536] (4 species)
  7. 670625Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)
  8. 670650Domain d2bd8a1: 2bd8 A:16-245 [128330]
    automatically matched to d1esb__
    complexed with arg, ca, phe, so4

Details for d2bd8a1

PDB Entry: 2bd8 (more details), 1.7 Å

PDB Description: porcine pancreatic elastase complexed with beta-casomorphin-7 and arg- phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 30 seconds
PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2bd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bd8a1 b.47.1.2 (A:16-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d2bd8a1:

Click to download the PDB-style file with coordinates for d2bd8a1.
(The format of our PDB-style files is described here.)

Timeline for d2bd8a1: