![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Elastase [50536] (4 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries) |
![]() | Domain d2bd8a1: 2bd8 A:16-245 [128330] automatically matched to d1esb__ complexed with arg, ca, phe, so4 |
PDB Entry: 2bd8 (more details), 1.7 Å
SCOP Domain Sequences for d2bd8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bd8a1 b.47.1.2 (A:16-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d2bd8a1: