SCOPe 2.06: Domain d2bd7a_: 2bd7 A:

Lineage for d2bd7a_ (2bd7 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)

8. Domain d2bd7a_: 2bd7 A: [128329]
   automated match to d1b0ea_
   complexed with arg, ca, phe, so4

Details for d2bd7a_

PDB Entry: 2bd7, 1.6 Å

PDB Description: porcine pancreatic elastase complexed with beta-casomorphin-7 and arg- phe at ph 5.0 (50 min soak)

PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2bd7a_:

Sequence; same for both SEQRES and ATOM records:

>d2bd7a_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2bd7a_:

• d2bd7a_ first appeared in SCOP 1.73, called d2bd7a1
  
• d2bd7a_ appears in SCOPe 2.05
  
• d2bd7a_ appears in SCOPe 2.07
  
• d2bd7a_ appears in the current release, SCOPe 2.08