SCOP 1.75: Domain d2bd0d1: 2bd0 D:2-241

Lineage for d2bd0d1 (2bd0 D:2-241)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Bacterial sepiapterin reductase [141892] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [141893] (1 PDB entry)
   Uniprot Q8KES3 2-241
   CT0609

8. Domain d2bd0d1: 2bd0 D:2-241 [128324]
   automatically matched to 2BD0 A:2-241
   complexed with bio, nap

Details for d2bd0d1

PDB Entry: 2bd0, 1.7 Å

PDB Description: chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin

PDB Compounds: (D:) sepiapterin reductase

SCOP Domain Sequences for d2bd0d1:

Sequence; same for both SEQRES and ATOM records:

>d2bd0d1 c.2.1.2 (D:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}
khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi

Timeline for d2bd0d1:

• d2bd0d1 first appeared in SCOP 1.73
  
• d2bd0d1 is called d2bd0d_ in SCOPe 2.01
  
• d2bd0d1 appears in the current release, SCOPe 2.08, called d2bd0d_