![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Bacterial sepiapterin reductase [141892] (1 species) |
![]() | Species Chlorobium tepidum [TaxId:1097] [141893] (1 PDB entry) Uniprot Q8KES3 2-241 CT0609 |
![]() | Domain d2bd0c1: 2bd0 C:2-241 [128323] automatically matched to 2BD0 A:2-241 complexed with bio, nap |
PDB Entry: 2bd0 (more details), 1.7 Å
SCOP Domain Sequences for d2bd0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bd0c1 c.2.1.2 (C:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi
Timeline for d2bd0c1: