Lineage for d2bd0c1 (2bd0 C:2-241)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819893Protein Bacterial sepiapterin reductase [141892] (1 species)
  7. 819894Species Chlorobium tepidum [TaxId:1097] [141893] (1 PDB entry)
    Uniprot Q8KES3 2-241
    CT0609
  8. 819897Domain d2bd0c1: 2bd0 C:2-241 [128323]
    automatically matched to 2BD0 A:2-241
    complexed with bio, nap

Details for d2bd0c1

PDB Entry: 2bd0 (more details), 1.7 Å

PDB Description: chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin
PDB Compounds: (C:) sepiapterin reductase

SCOP Domain Sequences for d2bd0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bd0c1 c.2.1.2 (C:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}
khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi

SCOP Domain Coordinates for d2bd0c1:

Click to download the PDB-style file with coordinates for d2bd0c1.
(The format of our PDB-style files is described here.)

Timeline for d2bd0c1: