Lineage for d2bd0c_ (2bd0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841618Protein Bacterial sepiapterin reductase [141892] (1 species)
  7. 2841619Species Chlorobium tepidum [TaxId:1097] [141893] (1 PDB entry)
    Uniprot Q8KES3 2-241
    CT0609
  8. 2841622Domain d2bd0c_: 2bd0 C: [128323]
    automated match to d2bd0a1
    complexed with bio, nap

Details for d2bd0c_

PDB Entry: 2bd0 (more details), 1.7 Å

PDB Description: chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin
PDB Compounds: (C:) sepiapterin reductase

SCOPe Domain Sequences for d2bd0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bd0c_ c.2.1.2 (C:) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}
khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi

SCOPe Domain Coordinates for d2bd0c_:

Click to download the PDB-style file with coordinates for d2bd0c_.
(The format of our PDB-style files is described here.)

Timeline for d2bd0c_: