SCOPe 2.08: Domain d2bd0b_: 2bd0 B:

Lineage for d2bd0b_ (2bd0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Bacterial sepiapterin reductase [141892] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [141893] (1 PDB entry)
   Uniprot Q8KES3 2-241
   CT0609

8. Domain d2bd0b_: 2bd0 B: [128322]
   automated match to d2bd0a1
   complexed with bio, nap

Details for d2bd0b_

PDB Entry: 2bd0, 1.7 Å

PDB Description: chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin

PDB Compounds: (B:) sepiapterin reductase

SCOPe Domain Sequences for d2bd0b_:

Sequence; same for both SEQRES and ATOM records:

>d2bd0b_ c.2.1.2 (B:) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}
khillitgagkgigraialefaraarhhpdfepvlvlssrtaadlekislecraegaltd
titadisdmadvrrltthiveryghidclvnnagvgrfgalsdlteedfdytmntnlkgt
ffltqalfalmerqhsghiffitsvaatkafrhssiycmskfgqrglvetmrlyarkcnv
ritdvqpgavytpmwgkvddemqalmmmpediaapvvqaylqpsrtvveeiilrptsgdi

Timeline for d2bd0b_:

• d2bd0b_ first appeared in SCOP 1.73, called d2bd0b1
  
• d2bd0b_ appears in SCOPe 2.07