Lineage for d2bcva2 (2bcv A:329-385)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329809Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2329810Protein automated matches [254483] (3 species)
    not a true protein
  7. 2329811Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)
  8. 2329814Domain d2bcva2: 2bcv A:329-385 [128317]
    Other proteins in same PDB: d2bcva1, d2bcva3
    automated match to d2pfna2
    protein/DNA complex; complexed with mg, na, ttp

Details for d2bcva2

PDB Entry: 2bcv (more details), 2 Å

PDB Description: DNA polymerase lambda in complex with Dttp and a DNA duplex containing an unpaired Dtmp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcva2 a.60.12.0 (A:329-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d2bcva2:

Click to download the PDB-style file with coordinates for d2bcva2.
(The format of our PDB-style files is described here.)

Timeline for d2bcva2: