SCOP 1.73: Domain d2bcva1: 2bcv A:253-327

Lineage for d2bcva1 (2bcv A:253-327)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (15 PDB entries)

8. Domain d2bcva1: 2bcv A:253-327 [128316]
   Other proteins in same PDB: d2bcva2, d2bcva3
   automatically matched to d1nzpa_
   complexed with mg, na, o2c, ttp

Details for d2bcva1

PDB Entry: 2bcv, 2 Å

PDB Description: DNA polymerase lambda in complex with Dttp and a DNA duplex containing an unpaired Dtmp

PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d2bcva1:

Sequence; same for both SEQRES and ATOM records:

>d2bcva1 a.60.6.1 (A:253-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
iieilesghlrkldh

Timeline for d2bcva1:

• d2bcva1 is new in SCOP 1.73
  
• d2bcva1 appears in SCOP 1.75
  
• d2bcva1 appears in the current release, SCOPe 2.08