Lineage for d2bcua3 (2bcu A:386-575)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006901Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 3007143Protein automated matches [254484] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255048] (4 PDB entries)
  8. 3007148Domain d2bcua3: 2bcu A:386-575 [128315]
    Other proteins in same PDB: d2bcua1, d2bcua2
    automated match to d2bcva3
    protein/DNA complex; complexed with na, ppv

Details for d2bcua3

PDB Entry: 2bcu (more details), 2.2 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp and a T:T mismatch
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcua3 d.218.1.2 (A:386-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d2bcua3:

Click to download the PDB-style file with coordinates for d2bcua3.
(The format of our PDB-style files is described here.)

Timeline for d2bcua3: