SCOPe 2.08: Domain d2bcua2: 2bcu A:329-385

Lineage for d2bcua2 (2bcu A:329-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.0: automated matches [254215] (1 protein)
   not a true family

6. Protein automated matches [254483] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)

8. Domain d2bcua2: 2bcu A:329-385 [128314]
   Other proteins in same PDB: d2bcua1, d2bcua3
   automated match to d2pfna2
   protein/DNA complex; complexed with na, ppv

Details for d2bcua2

PDB Entry: 2bcu, 2.2 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp and a T:T mismatch

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcua2:

Sequence; same for both SEQRES and ATOM records:

>d2bcua2 a.60.12.0 (A:329-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d2bcua2:

• d2bcua2 first appeared in SCOP 1.73
  
• d2bcua2 appears in SCOPe 2.07