Lineage for d2bcua2 (2bcu A:329-385)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. Protein automated matches [254483] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255047] (17 PDB entries)
  8. Domain d2bcua2: 2bcu A:329-385 [128314]
    Other proteins in same PDB: d2bcua1, d2bcua3
    automated match to d2pfna2
    protein/DNA complex; complexed with na, ppv

Details for d2bcua2

PDB Entry: 2bcu (more details), 2.2 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp and a T:T mismatch
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcua2 a.60.12.0 (A:329-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d2bcua2 are not available.

Timeline for d2bcua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bcua1, d2bcua3