Lineage for d2bcra3 (2bcr A:386-575)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239531Protein automated matches [254484] (3 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255048] (4 PDB entries)
  8. 2239533Domain d2bcra3: 2bcr A:386-575 [128309]
    Other proteins in same PDB: d2bcra1, d2bcra2
    automated match to d2bcqa3
    protein/DNA complex; complexed with edo, mg, na, ppv

Details for d2bcra3

PDB Entry: 2bcr (more details), 1.75 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcra3 d.218.1.2 (A:386-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d2bcra3:

Click to download the PDB-style file with coordinates for d2bcra3.
(The format of our PDB-style files is described here.)

Timeline for d2bcra3: