SCOPe 2.07: Domain d2bcra1: 2bcr A:251-328

Lineage for d2bcra1 (2bcr A:251-328)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries)

8. Domain d2bcra1: 2bcr A:251-328 [128307]
   Other proteins in same PDB: d2bcra2, d2bcra3
   automated match to d1rzta1
   protein/DNA complex; complexed with edo, mg, na, ppv

Details for d2bcra1

PDB Entry: 2bcr, 1.75 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Damp

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcra1:

Sequence; same for both SEQRES and ATOM records:

>d2bcra1 a.60.6.0 (A:251-328) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrma
ekiieilesghlrkldhi

Timeline for d2bcra1:

• d2bcra1 first appeared in SCOP 1.73
  
• d2bcra1 appears in SCOPe 2.06
  
• d2bcra1 appears in the current release, SCOPe 2.08