SCOPe 2.05: Domain d2bcqa1: 2bcq A:252-328

Lineage for d2bcqa1 (2bcq A:252-328)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (27 PDB entries)

8. Domain d2bcqa1: 2bcq A:252-328 [128304]
   Other proteins in same PDB: d2bcqa2, d2bcqa3
   automated match to d1rzta1
   protein/DNA complex; complexed with edo, mg, na, ppv

Details for d2bcqa1

PDB Entry: 2bcq, 1.65 Å

PDB Description: DNA polymerase lambda in complex with a DNA duplex containing an unpaired Dtmp

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d2bcqa1:

Sequence; same for both SEQRES and ATOM records:

>d2bcqa1 a.60.6.1 (A:252-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldhi

Timeline for d2bcqa1:

• d2bcqa1 first appeared in SCOP 1.73
  
• d2bcqa1 appears in SCOPe 2.04
  
• d2bcqa1 appears in SCOPe 2.06
  
• d2bcqa1 appears in the current release, SCOPe 2.08