Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.7: AstE/AspA-like [142526] (1 protein) Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (scop_cf 51229) |
Protein Succinylglutamate desuccinylase AstE [142527] (4 species) |
Species Vibrio parahaemolyticus [TaxId:670] [142529] (1 PDB entry) |
Domain d2bcoa1: 2bco A:4-342 [128302] complexed with zn |
PDB Entry: 2bco (more details), 2.33 Å
SCOP Domain Sequences for d2bcoa1:
Sequence, based on SEQRES records: (download)
>d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} slfrqsfltdtldvhidvapaeqvlsngvqlklyqrgvlevipenptqetkniiiscgih gdetapmelvdsiikdiesgfqkvdarclfiiahpestlahtrfleenlnrlfdekehep tkelaiadtlkllvrdfyqdtepktrwhldlhcairgskhytfavspktrhpvrskalvd fldsahieavllsnspsstfswysaenysaqaltmelgrvarigenaldrltafdlalrn liaeaqpehlskpcikyrvsrtivrlhddfdfmfddnvenftsfvhgevfghdgdkplma kndneaivfpnrhvaigqraalmvcevktrfeegelvyd
>d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} slfrqsfltdtldvhivapaeqvlsngvqlklyqrgvlevipenptqetkniiiscgihg detapmelvdsiikdiesgfqkvdarclfiiahpestlahtrfleenlnrlfdekehept kelaiadtlkllvrdfyqdtepktrwhldlhcairgskhytfavspktrhpvrskalvdf ldsahieavllsnspsstfswysaenysaqaltmelgrvarigenaldrltafdlalrnl iaeaqpehlskpcikyrvsrtivrlhddfdfmfddnvenftsfvhgevfghdgdkplmak ndneaivfpnrhvaigqraalmvcevktrfeegelvyd
Timeline for d2bcoa1: