Lineage for d2bcnb1 (2bcn B:1-108)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760825Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 760826Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (43 PDB entries)
    Uniprot P00044
  8. 760831Domain d2bcnb1: 2bcn B:1-108 [128300]
    Other proteins in same PDB: d2bcna1, d2bcnc1
    automatically matched to d1u74b_
    complexed with hem, znh; mutant

Details for d2bcnb1

PDB Entry: 2bcn (more details), 1.7 Å

PDB Description: solvent isotope effects on interfacial protein electron transfer between cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOP Domain Sequences for d2bcnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcnb1 a.3.1.1 (B:1-108) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOP Domain Coordinates for d2bcnb1:

Click to download the PDB-style file with coordinates for d2bcnb1.
(The format of our PDB-style files is described here.)

Timeline for d2bcnb1: