Lineage for d2bcnb_ (2bcn B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. Protein Mitochondrial cytochrome c [46642] (7 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (90 PDB entries)
    Uniprot P00044
  8. Domain d2bcnb_: 2bcn B: [128300]
    Other proteins in same PDB: d2bcna_, d2bcnc_
    automated match to d1u74b_
    complexed with hec, znh

Details for d2bcnb_

PDB Entry: 2bcn (more details), 1.7000000000000002 Å

PDB Description: solvent isotope effects on interfacial protein electron transfer between cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d2bcnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcnb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d2bcnb_ are not available.

Timeline for d2bcnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bcna_, d2bcnc_