Lineage for d2bcjq2 (2bcj Q:38-66,Q:184-354)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595281Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1595321Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 1595325Domain d2bcjq2: 2bcj Q:38-66,Q:184-354 [128292]
    Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb_, d2bcjg_, d2bcjq1
    G alpha-q
    complexed with alf, gdp, mg

Details for d2bcjq2

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (Q:) G alpha I1, Guanine nucleotide-binding protein G(q), alpha subunit

SCOPe Domain Sequences for d2bcjq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
relkllllgtgesgkstfikqmriihgsgXvpttgiieypfdlqsvifrmvdvggqrser
rkwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfl
nkkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatd
tenirfvfaavkdtilqlnlk

SCOPe Domain Coordinates for d2bcjq2:

Click to download the PDB-style file with coordinates for d2bcjq2.
(The format of our PDB-style files is described here.)

Timeline for d2bcjq2: