Lineage for d2bcjg_ (2bcj G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016391Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2016392Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2016393Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 2016394Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)
  8. 2016416Domain d2bcjg_: 2bcj G: [128290]
    Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb_, d2bcjq1, d2bcjq2
    automated match to d2trcg_
    complexed with alf, gdp, mg

Details for d2bcjg_

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOPe Domain Sequences for d2bcjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcjg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
nntasiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre
kkff

SCOPe Domain Coordinates for d2bcjg_:

Click to download the PDB-style file with coordinates for d2bcjg_.
(The format of our PDB-style files is described here.)

Timeline for d2bcjg_: