![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries) |
![]() | Domain d2bcjg_: 2bcj G: [128290] Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb_, d2bcjq1, d2bcjq2 automated match to d2trcg_ complexed with alf, gdp, mg |
PDB Entry: 2bcj (more details), 3.06 Å
SCOPe Domain Sequences for d2bcjg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcjg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} nntasiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre kkff
Timeline for d2bcjg_: