Class b: All beta proteins [48724] (174 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (3 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (18 PDB entries) |
Domain d2bcjb1: 2bcj B:2-340 [128289] Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjg1, d2bcjq1, d2bcjq2 automatically matched to d1tbga_ complexed with alf, gdp, mg |
PDB Entry: 2bcj (more details), 3.06 Å
SCOPe Domain Sequences for d2bcjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcjb1 b.69.4.1 (B:2-340) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam hwgtdsrllvsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk adragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d2bcjb1: