![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (1 family) ![]() |
![]() | Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (8 proteins) |
![]() | Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [89091] (3 PDB entries) |
![]() | Domain d2bcja1: 2bcj A:29-185 [128286] Other proteins in same PDB: d2bcja2, d2bcja3, d2bcjb1, d2bcjg1, d2bcjq1, d2bcjq2 automatically matched to d1omwa1 complexed with ace, alf, gdp, mg; mutant |
PDB Entry: 2bcj (more details), 3.06 Å
SCOP Domain Sequences for d2bcja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcja1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyee ikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqp yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d2bcja1:
![]() Domains from other chains: (mouse over for more information) d2bcjb1, d2bcjg1, d2bcjq1, d2bcjq2 |