![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein GTPase Ytp1 [110544] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110545] (2 PDB entries) Uniprot P01123 |
![]() | Domain d2bcgy_: 2bcg Y: [128285] Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgg3 automated match to d1ukvy_ complexed with gdp, ger, mg, trs |
PDB Entry: 2bcg (more details), 1.48 Å
SCOPe Domain Sequences for d2bcgy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcgy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett qkkedkgnvnlkgq
Timeline for d2bcgy_: