Lineage for d2bcgy_ (2bcg Y:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867265Protein GTPase Ytp1 [110544] (1 species)
  7. 2867266Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110545] (2 PDB entries)
    Uniprot P01123
  8. 2867268Domain d2bcgy_: 2bcg Y: [128285]
    Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgg3
    automated match to d1ukvy_
    complexed with gdp, ger, mg, trs

Details for d2bcgy_

PDB Entry: 2bcg (more details), 1.48 Å

PDB Description: structure of doubly prenylated ypt1:gdi complex
PDB Compounds: (Y:) GTP-binding protein YPT1

SCOPe Domain Sequences for d2bcgy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcgy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
qkkedkgnvnlkgq

SCOPe Domain Coordinates for d2bcgy_:

Click to download the PDB-style file with coordinates for d2bcgy_.
(The format of our PDB-style files is described here.)

Timeline for d2bcgy_: