![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.6: GDI-like [54399] (2 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
![]() | Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110818] (2 PDB entries) Uniprot P39958 5-446 |
![]() | Domain d2bcgg3: 2bcg G:302-399 [128284] Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgy_ automated match to d1ukvg3 complexed with gdp, ger, mg, trs |
PDB Entry: 2bcg (more details), 1.48 Å
SCOPe Domain Sequences for d2bcgg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl aiistiietdkphielepafkllgpieekfmgiaelfe
Timeline for d2bcgg3: