Lineage for d2bcgg3 (2bcg G:302-399)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404207Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1404208Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1404578Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1404579Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species)
  7. 1404580Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110818] (5 PDB entries)
    Uniprot P39958 5-446
  8. 1404581Domain d2bcgg3: 2bcg G:302-399 [128284]
    Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgy_
    automated match to d1ukvg3
    complexed with gdp, ger, mg, trs

Details for d2bcgg3

PDB Entry: 2bcg (more details), 1.48 Å

PDB Description: structure of doubly prenylated ypt1:gdi complex
PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitor

SCOPe Domain Sequences for d2bcgg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl
aiistiietdkphielepafkllgpieekfmgiaelfe

SCOPe Domain Coordinates for d2bcgg3:

Click to download the PDB-style file with coordinates for d2bcgg3.
(The format of our PDB-style files is described here.)

Timeline for d2bcgg3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bcgy_