Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.6: GDI-like [54399] (2 proteins) Similar to FAD-linked reductases in both domains but does not bind FAD |
Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110818] (5 PDB entries) Uniprot P39958 5-446 |
Domain d2bcgg3: 2bcg G:302-399 [128284] Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgy1 automatically matched to d1ukvg3 complexed with gdp, ger, mg, trs; mutant |
PDB Entry: 2bcg (more details), 1.48 Å
SCOP Domain Sequences for d2bcgg3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl aiistiietdkphielepafkllgpieekfmgiaelfe
Timeline for d2bcgg3: