SCOPe 2.08: Domain d2bcgg3: 2bcg G:302-399

Lineage for d2bcgg3 (2bcg G:302-399)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.6: GDI-like [54399] (2 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110818] (2 PDB entries)
   Uniprot P39958 5-446

8. Domain d2bcgg3: 2bcg G:302-399 [128284]
   Other proteins in same PDB: d2bcgg1, d2bcgg2, d2bcgy_
   automated match to d1ukvg3
   complexed with gdp, ger, mg, trs

Details for d2bcgg3

PDB Entry: 2bcg, 1.48 Å

PDB Description: structure of doubly prenylated ypt1:gdi complex

PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitor

SCOPe Domain Sequences for d2bcgg3:

Sequence; same for both SEQRES and ATOM records:

>d2bcgg3 d.16.1.6 (G:302-399) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstgqrviraicilnhpvpntsnadslqiiipqsqlgrksdiyvaivsdahnvcskghyl
aiistiietdkphielepafkllgpieekfmgiaelfe

Timeline for d2bcgg3:

• d2bcgg3 first appeared in SCOP 1.73
  
• d2bcgg3 appears in SCOPe 2.07