SCOPe 2.06: Domain d2bcgg2: 2bcg G:400-446

Lineage for d2bcgg2 (2bcg G:400-446)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
   Similar to FAD-linked reductases in both domains but does not bind FAD

6. Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
   the inhibition function is probably associated with an insert subdomain, residues 120-220

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (2 PDB entries)
   Uniprot P39958 5-446

8. Domain d2bcgg2: 2bcg G:400-446 [128283]
   Other proteins in same PDB: d2bcgg3, d2bcgy_
   automated match to d1ukvg2
   complexed with gdp, ger, mg, trs

Details for d2bcgg2

PDB Entry: 2bcg, 1.48 Å

PDB Description: structure of doubly prenylated ypt1:gdi complex

PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitor

SCOPe Domain Sequences for d2bcgg2:

Sequence; same for both SEQRES and ATOM records:

>d2bcgg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqrq

Timeline for d2bcgg2:

• d2bcgg2 first appeared in SCOP 1.73
  
• d2bcgg2 appears in SCOPe 2.05
  
• d2bcgg2 appears in SCOPe 2.07
  
• d2bcgg2 appears in the current release, SCOPe 2.08