Lineage for d2bcgg2 (2bcg G:400-446)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 689014Family c.3.1.3: GDI-like N domain [51931] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 689015Protein Guanine nucleotide dissociation inhibitor, GDI [51932] (2 species)
    the inhibition function is probably associated with an insert subdomain, residues 120-220
  7. 689016Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110439] (2 PDB entries)
  8. 689018Domain d2bcgg2: 2bcg G:400-446 [128283]
    Other proteins in same PDB: d2bcgg3, d2bcgy1
    automatically matched to d1ukvg2
    complexed with gdp, ger, mg, trs; mutant

Details for d2bcgg2

PDB Entry: 2bcg (more details), 1.48 Å

PDB Description: structure of doubly prenylated ypt1:gdi complex
PDB Compounds: (G:) Secretory pathway GDP dissociation inhibitor

SCOP Domain Sequences for d2bcgg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcgg2 c.3.1.3 (G:400-446) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
predgskdniylsrsydasshfesmtddvkdiyfrvtghplvlkqrq

SCOP Domain Coordinates for d2bcgg2:

Click to download the PDB-style file with coordinates for d2bcgg2.
(The format of our PDB-style files is described here.)

Timeline for d2bcgg2:

Domains from other chains:
(mouse over for more information)
d2bcgy1