Lineage for d2bcda1 (2bcd A:6-298)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736785Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 736786Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 736829Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)
  6. 736841Protein Protein phosphatase-1 (PP-1) [56311] (3 species)
  7. 736842Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (5 PDB entries)
  8. 736847Domain d2bcda1: 2bcd A:6-298 [128281]
    automatically matched to d1jk7a_
    complexed with bme, mn, moq

Details for d2bcda1

PDB Entry: 2bcd (more details), 2.1 Å

PDB Description: X-ray crystal structure of Protein Phosphatase-1 with the marine toxin motuporin bound
PDB Compounds: (A:) serine/threonine protein phosphatase pp1-gamma catalytic subunit

SCOP Domain Sequences for d2bcda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcda1 d.159.1.3 (A:6-298) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

SCOP Domain Coordinates for d2bcda1:

Click to download the PDB-style file with coordinates for d2bcda1.
(The format of our PDB-style files is described here.)

Timeline for d2bcda1: