![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) |
![]() | Protein Streptavidin [50878] (1 species) |
![]() | Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries) |
![]() | Domain d2bc3b1: 2bc3 B:14-135 [128280] automatically matched to d1hy2a_ complexed with gol, so4 |
PDB Entry: 2bc3 (more details), 1.54 Å
SCOP Domain Sequences for d2bc3b1:
Sequence, based on SEQRES records: (download)
>d2bc3b1 b.61.1.1 (B:14-135) Streptavidin {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv kp
>d2bc3b1 b.61.1.1 (B:14-135) Streptavidin {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesanaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
Timeline for d2bc3b1: