Lineage for d2bc3a_ (2bc3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1801148Protein automated matches [190191] (2 species)
    not a true protein
  7. 1801229Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)
  8. 1801262Domain d2bc3a_: 2bc3 A: [128279]
    automated match to d2bc3b_
    complexed with gol, so4

Details for d2bc3a_

PDB Entry: 2bc3 (more details), 1.54 Å

PDB Description: T7-tagged full-length streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2bc3a_:

Sequence, based on SEQRES records: (download)

>d2bc3a_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaasidaakkagvnngnpldavqq

Sequence, based on observed residues (ATOM records): (download)

>d2bc3a_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
psaasidaakkagvnngnpldavqq

SCOPe Domain Coordinates for d2bc3a_:

Click to download the PDB-style file with coordinates for d2bc3a_.
(The format of our PDB-style files is described here.)

Timeline for d2bc3a_: