Lineage for d2bc3a2 (2bc3 A:14-159)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806263Domain d2bc3a2: 2bc3 A:14-159 [128279]
    Other proteins in same PDB: d2bc3a3
    automated match to d2bc3b_
    complexed with gol, so4

Details for d2bc3a2

PDB Entry: 2bc3 (more details), 1.54 Å

PDB Description: t7-tagged full-length streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2bc3a2:

Sequence, based on SEQRES records: (download)

>d2bc3a2 b.61.1.1 (A:14-159) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
kpsaasidaakkagvnngnpldavqq

Sequence, based on observed residues (ATOM records): (download)

>d2bc3a2 b.61.1.1 (A:14-159) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
saasidaakkagvnngnpldavqq

SCOPe Domain Coordinates for d2bc3a2:

Click to download the PDB-style file with coordinates for d2bc3a2.
(The format of our PDB-style files is described here.)

Timeline for d2bc3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bc3a3
View in 3D
Domains from other chains:
(mouse over for more information)
d2bc3b_