Lineage for d2bbfa1 (2bbf A:11-382)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 819122Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 819123Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 819134Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 819135Species Zymomonas mobilis [TaxId:542] [51716] (33 PDB entries)
    Uniprot P28720
  8. 819142Domain d2bbfa1: 2bbf A:11-382 [128265]
    automatically matched to d1q2ra_
    complexed with 344, zn

Details for d2bbfa1

PDB Entry: 2bbf (more details), 1.7 Å

PDB Description: crystal structure of trna-guanine transglycosylase (tgt) from zymomonas mobilis in complex with 6-amino-3,7-dihydro-imidazo[4,5- g]quinazolin-8-one
PDB Compounds: (A:) tRNA guanine transglycosylase

SCOP Domain Sequences for d2bbfa1:

Sequence, based on SEQRES records: (download)

>d2bbfa1 c.1.20.1 (A:11-382) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

Sequence, based on observed residues (ATOM records): (download)

>d2bbfa1 c.1.20.1 (A:11-382) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmsltkqseegvtfkshlsrhml
spersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaen
aalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddk
phylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpld
sechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaq
dfraryf

SCOP Domain Coordinates for d2bbfa1:

Click to download the PDB-style file with coordinates for d2bbfa1.
(The format of our PDB-style files is described here.)

Timeline for d2bbfa1: