Lineage for d2bb3b_ (2bb3 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877645Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 1877646Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 1877647Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 1877820Protein Precorrin-6y methylase CbiE [142785] (1 species)
  7. 1877821Species Archaeoglobus fulgidus [TaxId:2234] [142786] (1 PDB entry)
    Uniprot O29536 1-195
  8. 1877823Domain d2bb3b_: 2bb3 B: [128258]
    automated match to d2bb3a1
    complexed with sah

Details for d2bb3b_

PDB Entry: 2bb3 (more details), 2.27 Å

PDB Description: Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus
PDB Compounds: (B:) cobalamin biosynthesis precorrin-6Y methylase (cbiE)

SCOPe Domain Sequences for d2bb3b_:

Sequence, based on SEQRES records: (download)

>d2bb3b_ c.90.1.1 (B:) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
ghmiwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeir
rimeegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsev
avvdchakdfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnad
sielesdytiifverev

Sequence, based on observed residues (ATOM records): (download)

>d2bb3b_ c.90.1.1 (B:) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
ghmiwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeir
rimeegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsev
avvdchaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsiele
sdytiifverev

SCOPe Domain Coordinates for d2bb3b_:

Click to download the PDB-style file with coordinates for d2bb3b_.
(The format of our PDB-style files is described here.)

Timeline for d2bb3b_: