SCOP 1.73: Domain d2bb3b1: 2bb3 B:1-195

Lineage for d2bb3b1 (2bb3 B:1-195)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
   Pfam PF00590

6. Protein Precorrin-6y methylase CbiE [142785] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142786] (1 PDB entry)

8. Domain d2bb3b1: 2bb3 B:1-195 [128258]
   automatically matched to 2BB3 A:1-195
   complexed with sah

Details for d2bb3b1

PDB Entry: 2bb3, 2.27 Å

PDB Description: Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus

PDB Compounds: (B:) cobalamin biosynthesis precorrin-6Y methylase (cbiE)

SCOP Domain Sequences for d2bb3b1:

Sequence, based on SEQRES records:

>d2bb3b1 c.90.1.1 (B:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdchakdfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsi
elesdytiifverev

Sequence, based on observed residues (ATOM records):

>d2bb3b1 c.90.1.1 (B:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdchaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsielesd
ytiifverev

Timeline for d2bb3b1:

• d2bb3b1 is new in SCOP 1.73
  
• d2bb3b1 appears in SCOP 1.75
  
• d2bb3b1 appears in the current release, SCOPe 2.08, called d2bb3b2