Lineage for d2bb3b2 (2bb3 B:1-195)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2142837Family c.90.1.1: Tetrapyrrole methylase [53791] (8 protein domains)
    Pfam PF00590
  6. 2143010Protein Precorrin-6y methylase CbiE [142785] (1 species)
  7. 2143011Species Archaeoglobus fulgidus [TaxId:2234] [142786] (1 PDB entry)
    Uniprot O29536 1-195
  8. 2143013Domain d2bb3b2: 2bb3 B:1-195 [128258]
    Other proteins in same PDB: d2bb3a2, d2bb3b3
    automated match to d2bb3a1
    complexed with sah

Details for d2bb3b2

PDB Entry: 2bb3 (more details), 2.27 Å

PDB Description: Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus
PDB Compounds: (B:) cobalamin biosynthesis precorrin-6Y methylase (cbiE)

SCOPe Domain Sequences for d2bb3b2:

Sequence, based on SEQRES records: (download)

>d2bb3b2 c.90.1.1 (B:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdchakdfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsi
elesdytiifverev

Sequence, based on observed residues (ATOM records): (download)

>d2bb3b2 c.90.1.1 (B:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdchaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsielesd
ytiifverev

SCOPe Domain Coordinates for d2bb3b2:

Click to download the PDB-style file with coordinates for d2bb3b2.
(The format of our PDB-style files is described here.)

Timeline for d2bb3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bb3b3