Lineage for d2bb3a1 (2bb3 A:1-195)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710141Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 710142Superfamily c.90.1: Tetrapyrrole methylase [53790] (1 family) (S)
  5. 710143Family c.90.1.1: Tetrapyrrole methylase [53791] (7 proteins)
    Pfam PF00590
  6. 710167Protein Precorrin-6y methylase CbiE [142785] (1 species)
  7. 710168Species Archaeoglobus fulgidus [TaxId:2234] [142786] (1 PDB entry)
  8. 710169Domain d2bb3a1: 2bb3 A:1-195 [128257]
    complexed with sah

Details for d2bb3a1

PDB Entry: 2bb3 (more details), 2.27 Å

PDB Description: Crystal Structure of Cobalamin Biosynthesis Precorrin-6Y Methylase (cbiE) from Archaeoglobus fulgidus
PDB Compounds: (A:) cobalamin biosynthesis precorrin-6Y methylase (cbiE)

SCOP Domain Sequences for d2bb3a1:

Sequence, based on SEQRES records: (download)

>d2bb3a1 c.90.1.1 (A:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdchakdfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsi
elesdytiifverev

Sequence, based on observed residues (ATOM records): (download)

>d2bb3a1 c.90.1.1 (A:1-195) Precorrin-6y methylase CbiE {Archaeoglobus fulgidus [TaxId: 2234]}
miwivgsgtcrgqtterakeiieraeviygsrralelagvvddsrarilrsfkgdeirri
meegrerevavistgdpmvaglgrvlreiaedveikiepaissvqvalarlkvdlsevav
vdcfdaeltellkyrhlliladshfplerlgkrrvvllenlcmegeriregnadsieles
dytiifverev

SCOP Domain Coordinates for d2bb3a1:

Click to download the PDB-style file with coordinates for d2bb3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bb3a1: