Lineage for d2bayb_ (2bay B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037595Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 3037617Protein automated matches [190212] (2 species)
    not a true protein
  7. 3037618Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186968] (1 PDB entry)
  8. 3037620Domain d2bayb_: 2bay B: [128252]
    Other proteins in same PDB: d2bayd3, d2baye3, d2bayf3
    automated match to d1n87a_

Details for d2bayb_

PDB Entry: 2bay (more details), 1.5 Å

PDB Description: Crystal structure of the Prp19 U-box dimer
PDB Compounds: (B:) Pre-mRNA splicing factor PRP19

SCOPe Domain Sequences for d2bayb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bayb_ g.44.1.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps

SCOPe Domain Coordinates for d2bayb_:

Click to download the PDB-style file with coordinates for d2bayb_.
(The format of our PDB-style files is described here.)

Timeline for d2bayb_: