Lineage for d2baxa1 (2bax A:1-123)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649178Protein Phospholipase A2 [48637] (4 species)
  7. 649179Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (26 PDB entries)
  8. 649182Domain d2baxa1: 2bax A:1-123 [128250]
    automatically matched to d1c74a_
    complexed with ca, cl, mpd, mrd; mutant

Details for d2baxa1

PDB Entry: 2bax (more details), 1.1 Å

PDB Description: atomic resolution structure of the double mutant (k53,56m) of bovine pancreatic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOP Domain Sequences for d2baxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2baxa1 a.133.1.2 (A:1-123) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
knc

SCOP Domain Coordinates for d2baxa1:

Click to download the PDB-style file with coordinates for d2baxa1.
(The format of our PDB-style files is described here.)

Timeline for d2baxa1: