Lineage for d2bawb1 (2baw B:211-476)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648142Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 648143Species Human (Homo sapiens) [TaxId:9606] [48527] (8 PDB entries)
  8. 648149Domain d2bawb1: 2baw B:211-476 [128249]
    automatically matched to d2gwxb_
    complexed with b7g, vca

Details for d2bawb1

PDB Entry: 2baw (more details), 2.3 Å

PDB Description: human nuclear receptor-ligand complex 1
PDB Compounds: (B:) Peroxisome proliferator activated receptor delta

SCOP Domain Sequences for d2bawb1:

Sequence, based on SEQRES records: (download)

>d2bawb1 a.123.1.1 (B:211-476) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d2bawb1 a.123.1.1 (B:211-476) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltpfvihdietlwqaekglkeisvhvfyrcqctt
vetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvangsgfvt
reflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvprveai
qdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetetslhpll
qeiykdm

SCOP Domain Coordinates for d2bawb1:

Click to download the PDB-style file with coordinates for d2bawb1.
(The format of our PDB-style files is described here.)

Timeline for d2bawb1: