SCOP 1.73: Domain d2basa2: 2bas A:263-407

Lineage for d2basa2 (2bas A:263-407)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (2 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.2: YkuI C-terminal domain-like [143732] (1 protein)
   PfamB 021678

6. Protein Hypothetical protein YkuI, C-terminal domain [143733] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143734] (1 PDB entry)

8. Domain d2basa2: 2bas A:263-407 [128245]
   Other proteins in same PDB: d2basa1, d2basb1
   complexed with bme

Details for d2basa2

PDB Entry: 2bas, 2.61 Å

PDB Description: crystal structure of the bacillus subtilis ykui protein, with an eal domain.

PDB Compounds: (A:) YkuI protein

SCOP Domain Sequences for d2basa2:

Sequence; same for both SEQRES and ATOM records:

>d2basa2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
kkletvyehseqfykrvhqavtslrknnlssdddfikklaeeltdcsfriymcdeegdql
tgnvfkqdgewiyqpeyaeknwswrpyflenimrmrnlrkgffsdlysdletgemirtfs
ypmddqmylfidlpysylyeqdgli

Timeline for d2basa2:

• d2basa2 is new in SCOP 1.73
  
• d2basa2 appears in SCOP 1.75
  
• d2basa2 appears in the current release, SCOPe 2.08